Glutathione Peroxidase 4 (GPX4) Rabbit Polyclonal Antibody

CAT#: TA344322

Rabbit Polyclonal Anti-GPX4 Antibody - middle region

Product Images

GPX4 antibody - middle region validated by WB using HepG2 cell lysate at 1.0 ug/ml.GPX4 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Immunohistochemistry with Rat Brain lysate tissue

• 

  Immunohistochemistry with Heart cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-GPX4 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: glutathione peroxidase 4
• Database Link:
  NP_002076
  Entrez Gene 2879 Human
  UniProt ID P36969
• Background: Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.
• Synonyms: GPx-4; GSHPx-4; MCSP; PHGPx; snGPx; snPHGPx
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 93%; Pig: 86%; Rat: 86%; Goat: 86%; Mouse: 86%; Bovine: 86%; Zebrafish: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Arachidonic acid metabolism, Glutathione metabolism