EEF2 Rabbit Polyclonal Antibody

CAT#: TA344333

Rabbit Polyclonal Anti-EEF2 Antibody - N-terminal region

Product Images

WB Suggested Anti-EEF2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate

• 

  Small intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EEF2 antibody: synthetic peptide directed towards the N terminal of human EEF2. Synthetic peptide located within the following region: TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 94 kDa
• Gene Name: eukaryotic translation elongation factor 2
• Database Link:
  NP_001952
  Entrez Gene 1938 Human
  UniProt ID P13639
• Background: EEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: EEF-2; EF-2; EF2; SCA26
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%