DUSP22 Rabbit Polyclonal Antibody

CAT#: TA344334

Rabbit Polyclonal Anti-DUSP22 Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: DUSP22; Sample Tissue: Thyroid Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DUSP22 antibody is: synthetic peptide directed towards the N-terminal region of Human DUSP22. Synthetic peptide located within the following region: LPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: dual specificity phosphatase 22
• Database Link:
  NP_064570
  Entrez Gene 56940 Human
  UniProt ID Q9NRW4
• Background: DUSP22 activates the Jnk signaling pathway. It dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK).
• Synonyms: JKAP; JSP-1; JSP1; LMW-DSP2; LMWDSP2; MKP-x; MKPX; VHX
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Pig: 91%; Guinea pig: 91%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Phosphatase