CAPZB Rabbit Polyclonal Antibody

CAT#: TA344343

Rabbit Polyclonal Anti-CAPZB Antibody - C-terminal region

Product Images

WB Suggested Anti-Capzb Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Capzb antibody is: synthetic peptide directed towards the C-terminal region of Rat Capzb. Synthetic peptide located within the following region: VEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: capping actin protein of muscle Z-line beta subunit
• Database Link:
  NP_004921
  Entrez Gene 298584 Rat
  UniProt ID P47756
• Background: F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.
• Synonyms: CAPB; CAPPB; CAPZ
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%