SNAP47 Rabbit Polyclonal Antibody

CAT#: TA344347

Rabbit Polyclonal Anti-C1orf142 Antibody - middle region

Product Images

WB Suggested Anti-C1orf142 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C1orf142 antibody: synthetic peptide directed towards the middle region of human C1orf142. Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: synaptosome associated protein 47kDa
• Database Link:
  NP_444280
  Entrez Gene 116841 Human
  UniProt ID Q5SQN1
• Background: The function of this protein remains unknown.
• Synonyms: C1orf142; ESFI5812; HEL-S-290; HEL170; SNAP-47; SVAP1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Zebrafish: 92%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Rat: 79%; Mouse: 79%; Yeast: 75%

Reference Data

• Protein Pathways: SNARE interactions in vesicular transport