TNKS1BP1 Rabbit Polyclonal Antibody

CAT#: TA344370

Rabbit Polyclonal Anti-TNKS1BP1 Antibody - middle region

Product Images

WB Suggested Anti-TNKS1BP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TNKS1BP1 antibody: synthetic peptide directed towards the middle region of human TNKS1BP1. Synthetic peptide located within the following region: DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 190 kDa
• Gene Name: tankyrase 1 binding protein 1
• Database Link:
  NP_203754
  Entrez Gene 85456 Human
  UniProt ID Q9C0C2
• Background: TNKS-1 mRNA in urine sediment from patients with bladder TCC correlated with tumor stage, and higher preoperative levels were associated with increased risk of early recurrence. Tankyrase-1 is required in the assembly of bipolar spindles and the spindle-pole protein NuMA as a substrate for covalent modification by tankyrase-1. Data also show that tankyrase 1 inhibition in human cancer cells enhances telomere shortening by a telomerase inhibitor and hastens cell death.
• Synonyms: TAB182
• Note: Immunogen Sequence Homology: Human: 100%