ASF1A Rabbit Polyclonal Antibody

CAT#: TA344398

Rabbit Polyclonal Anti-ASF1A Antibody - N-terminal region

Product Images

WB Suggested Anti-ASF1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASF1A antibody: synthetic peptide directed towards the N terminal of human ASF1A. Synthetic peptide located within the following region: MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: anti-silencing function 1A histone chaperone
• Database Link:
  NP_054753
  Entrez Gene 25842 Human
  UniProt ID Q9Y294
• Background: This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The protein is a key component of a histone donor complex that functions in nucleosome assembly. It interacts with histones H3 and H4, and functions together with a chromatin assembly factor during DNA replication and repair.
• Synonyms: CGI-98; CIA; HSPC146
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%; Goat: 79%