GTF2A1 Rabbit Polyclonal Antibody

CAT#: TA344433

Rabbit Polyclonal Anti-GTF2A1 Antibody - middle region

Product Images

WB Suggested Anti-GTF2A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the middle region of human GTF2A1. Synthetic peptide located within the following region: GQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: general transcription factor IIA subunit 1
• Database Link:
  NP_963889
  Entrez Gene 2957 Human
  UniProt ID P52655
• Background: Transcription initiation factor IIA . and . chains (GTF2A1, TFIIA p35 and p19 subunits, TFIIAL) binding ability of TLP is required for characteristic cytoplasmic localization of TLP. TFIIA may regulate the intracellular molecular state and the function of TLP through its property of binding to TLP.
• Synonyms: TF2A1; TFIIA; TFIIA-42; TFIIAL
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Yeast: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Basal transcription factors