GTF2A1 Rabbit Polyclonal Antibody

CAT#: TA344434

Rabbit Polyclonal Anti-GTF2A1 Antibody - N-terminal region

Product Images

WB Suggested Anti-GTF2A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the N terminal of human GTF2A1. Synthetic peptide located within the following region: ANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: general transcription factor IIA subunit 1
• Database Link:
  NP_056943
  Entrez Gene 2957 Human
  UniProt ID P52655
• Background: GTF2A1 belongs to the TFIIA subunit 1 family. It is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. This protein induces a conformational change within the TBP/TATA complex that enhances its stability under both in vitro and physiological salt conditions.
• Synonyms: TF2A1; TFIIA; TFIIA-42; TFIIAL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Basal transcription factors