Calreticulin (CALR) Rabbit Polyclonal Antibody

CAT#: TA344448

Rabbit Polyclonal Anti-CALR Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: CALR; Sample Tissue: 721_B Whole cell lysates; Antibody Dilution: 1.0 ug/ml; There is BioGPS gene expression data showing that CALR is expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CALR antibody is: synthetic peptide directed towards the N-terminal region of Human CALR. Synthetic peptide located within the following region: SSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: calreticulin
• Database Link:
  NP_004334
  Entrez Gene 811 Human
  UniProt ID P27797
• Background: Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum.
• Synonyms: cC1qR; CRT; HEL-S-99n; RO; SSA
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transcription Factors
• Protein Pathways: Antigen processing and presentation