THRAP5 (MED16) Rabbit Polyclonal Antibody

CAT#: TA344539

Rabbit Polyclonal Anti-MED16 Antibody - C-terminal region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "MED16"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MED16 antibody: synthetic peptide directed towards the C terminal of human MED16. Synthetic peptide located within the following region: MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 97 kDa
Gene Name mediator complex subunit 16
Background THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators.
Synonyms DRIP92; THRAP5; TRAP95
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 92%; Rat: 92%; Bovine: 92%; Mouse: 85%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.