GTF3C5 Rabbit Polyclonal Antibody

CAT#: TA344542

Rabbit Polyclonal Anti-Gtf3c5 Antibody - middle region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of general transcription factor IIIC, polypeptide 5, 63kDa (GTF3C5), transcript variant 1
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "GTF3C5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Gtf3c5 antibody is: synthetic peptide directed towards the middle region of Rat Gtf3c5. Synthetic peptide located within the following region: IRFGYDPRKHPDAKIYQVLDFRIRCGMKYGYGSRDMPVKAKRSTYNYSLP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 56 kDa
Gene Name general transcription factor IIIC subunit 5
Background The function of this protein remains unknown.
Synonyms TFiiiC2-63; TFIIIC63; TFIIICepsilon
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Zebrafish: 86%; Guinea pig: 86%; Yeast: 82%; Horse: 77%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.