HOXD1 Rabbit Polyclonal Antibody

CAT#: TA344560

Rabbit Polyclonal Anti-HOXD1 Antibody - middle region

Product Images

WB Suggested Anti-HOXD1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HOXD1 antibody: synthetic peptide directed towards the middle region of human HOXD1. Synthetic peptide located within the following region: QNRRMKQKKREREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: homeobox D1
• Database Link:
  NP_078777
  Entrez Gene 3231 Human
  UniProt ID Q9GZZ0
• Background: HOXD1 is a protein with a homeobox DNA-binding domain, and it belongs to the Antp homeobox family. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene
• Synonyms: Hox-4.7; HOX4; HOX4G
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors