Hemogen (HEMGN) Rabbit Polyclonal Antibody

CAT#: TA344598

Rabbit Polyclonal Anti-HEMGN Antibody - N-terminal region

Product Images

WB Suggested Anti-HEMGN Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HEMGN antibody: synthetic peptide directed towards the N terminal of human HEMGN. Synthetic peptide located within the following region: MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: hemogen
• Database Link:
  NP_932095
  Entrez Gene 55363 Human
  UniProt ID Q9BXL5
• Background: HEMGN regulates the proliferation and differentiation of hematopoietic cells. Overexpression of HEMGN block the TPA-induced megakaryocytic differentiation in the K562 cell model. HEMGN may also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).
• Synonyms: CT155; EDAG; EDAG-1; NDR
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 79%