PPM1A Rabbit Polyclonal Antibody

CAT#: TA344616

Rabbit Polyclonal Anti-PPM1A Antibody - middle region

Product Images

WB Suggested Anti-PPM1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPM1A antibody: synthetic peptide directed towards the middle region of human PPM1A. Synthetic peptide located within the following region: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: protein phosphatase, Mg2+/Mn2+ dependent 1A
• Database Link:
  NP_808820
  Entrez Gene 5494 Human
  UniProt ID P35813
• Background: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the acti
• Synonyms: PP2C-ALPHA; PP2CA; PP2Calpha
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: MAPK signaling pathway