MTMR14 Rabbit Polyclonal Antibody

CAT#: TA344677

Rabbit Polyclonal Anti-MTMR14 Antibody - middle region

Product Images

WB Suggested Anti-MTMR14 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MTMR14 antibody: synthetic peptide directed towards the middle region of human MTMR14. Synthetic peptide located within the following region: NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: myotubularin related protein 14
• Database Link:
  NP_001070993
  Entrez Gene 64419 Human
  UniProt ID Q8NCE2
• Background: This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.
• Synonyms: C3orf29
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Phosphatase, Secreted Protein