Vipas39 Rabbit Polyclonal Antibody

CAT#: TA344707

Rabbit Polyclonal Anti-LOC681989 Antibody - middle region

Product Images

Host: Rabbit; Target Name: LOC681989; Sample Tissue: Rat Thymus lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LOC681989 antibody is: synthetic peptide directed towards the middle region of Rat LOC681989. Synthetic peptide located within the following region: PPSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKTYSPELGRPKGEYRDYS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog
• Database Link:
  NP_001094474
  Entrez Gene 681989 Rat
  UniProt ID Q5PQN6
• Background: LOC681989 plays a role in lysosomal trafficking, probably via association with the core HOPS complex in a discrete population of endosomes. It may play a role in epithelial polarization through stabilization of apical membrane protein content, possibly via the RAB11A-dependent apical recycling pathway. It is also involved in direct or indirect transcriptional regulation of E-cadherin and may play a role in vesicular trafficking during spermatogenesis.
• Synonyms: C14orf133; hSPE-39; SPE-39; SPE39; VIPAR; VPS16B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%