CoCoA (CALCOCO1) Rabbit Polyclonal Antibody

CAT#: TA344754

Rabbit Polyclonal Anti-CALCOCO1 Antibody

Product Images

WB Suggested Anti-CALCOCO1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CALCOCO1 antibody: synthetic peptide directed towards the N terminal of human CALCOCO1. Synthetic peptide located within the following region: ESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: calcium binding and coiled-coil domain 1
• Database Link:
  NP_065949
  Entrez Gene 57658 Human
  UniProt ID Q9P1Z2
• Background: CALCOCO1 functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR).CALCOCO1 is recruited to promoters through its contact with the N-terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2. During ER-activation CALCOCO1 acts synergistically in combination with other NCOA2-binding proteins, such as EP300, CREBBP and CARM1. CALCOCO1 is involved in the transcriptional activation of target genes in the Wnt/CTNNB1 pathway. CALCOCO1 functions as a secondary coactivator in LEF1-mediated transcriptional activation via its interaction with CTNNB1. Coactivator function for nuclear receptors and LEF1/CTNNB1 involves differential utilization of two different activation regions.
• Synonyms: calphoglin; Cocoa; PP13275
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors