ACTR3B Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human ARP3 actin-related protein 3 homolog B (yeast) (ACTR3B), transcript variant 1
USD 823.00
Transient overexpression lysate of ARP3 actin-related protein 3 homolog B (yeast) (ACTR3B), transcript variant 1
USD 396.00
Other products for "ACTR3B"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ACTR3B antibody: synthetic peptide directed towards the N terminal of human ACTR3B. Synthetic peptide located within the following region: DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 47 kDa |
Gene Name | ARP3 actin-related protein 3 homolog B (yeast) |
Database Link | |
Background | ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors. |
Synonyms | ARP3BETA; ARP11 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.