ENAH Rabbit Polyclonal Antibody

CAT#: TA344908

Rabbit Polyclonal Anti-ENAH Antibody - C-terminal region

Product Images

Host: Rabbit; Target Name: Enah; Sample Tissue: Mouse Thymus lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Enah antibody is: synthetic peptide directed towards the C-terminal region of Mouse Enah. Synthetic peptide located within the following region: RRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: enabled homolog (Drosophila)
• Database Link:
  NP_001008493
  Entrez Gene 13800 Mouse
  UniProt ID Q8N8S7
• Background: The function of this protein remains unknown.
• Synonyms: ENA; MENA; NDPP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Mouse: 92%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Pathways: Regulation of actin cytoskeleton