C14orf104 (DNAAF2) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human chromosome 14 open reading frame 104 (C14orf104), transcript variant 1
USD 867.00
Transient overexpression lysate of chromosome 14 open reading frame 104 (C14orf104), transcript variant 1
USD 605.00
Other products for "DNAAF2"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | IHC, WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C14orf104 antibody: synthetic peptide directed towards the N terminal of human C14orf104. Synthetic peptide located within the following region: MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 91 kDa |
Gene Name | dynein (axonemal) assembly factor 2 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | C14orf104; CILD10; KTU; PF13 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.