C14orf104 (DNAAF2) Rabbit Polyclonal Antibody

CAT#: TA344923

Rabbit Polyclonal Anti-C14orf104 Antibody - N-terminal region

Product Images

WB Suggested Anti-C14orf104 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

• 

  ; Application: IHC; Species+tissue/cell type:Human nasal epithelial cells; Primary antibody dilution: 1:500; Secondary antibody: Goat anti-rabbit Alexa Fluor 546; Secondary antibody dilution:1:1000

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C14orf104 antibody: synthetic peptide directed towards the N terminal of human C14orf104. Synthetic peptide located within the following region: MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: dynein (axonemal) assembly factor 2
• Database Link:
  NP_060609
  Entrez Gene 55172 Human
  UniProt ID Q9NVR5
• Background: The function of this protein remains unknown.
• Synonyms: C14orf104; CILD10; KTU; PF13
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%