GPATCH2 Rabbit Polyclonal Antibody

CAT#: TA344940

Rabbit Polyclonal Anti-GPATCH2 Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: Gpatch2; Sample Tissue: Mouse Spleen lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Gpatch2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gpatch2. Synthetic peptide located within the following region: RSYNVHHPWETGHCLSEGSDSSLEEPSKDYREKHSNNKKDRSDSDDQMLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: G-patch domain containing 2
• Database Link:
  NP_060510
  Entrez Gene 67769 Mouse
  UniProt ID Q9NW75
• Background: The function of this protein remains unknown.
• Synonyms: CT110; GPATC2; PPP1R30
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93%; Rabbit: 86%