MRPL37 Rabbit Polyclonal Antibody

CAT#: TA345017

Rabbit Polyclonal Anti-MRPL37 Antibody - N-terminal region

Product Images

WB Suggested Anti-MRPL37 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MRPL37 antibody: synthetic peptide directed towards the N terminal of human MRPL37. Synthetic peptide located within the following region: VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: mitochondrial ribosomal protein L37
• Database Link:
  NP_057575
  Entrez Gene 51253 Human
  UniProt ID Q9BZE1
• Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• Synonyms: L37mt; MRP-L2; MRP-L37; MRPL2; RPML2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 86%