MFAP1 Rabbit Polyclonal Antibody

CAT#: TA345166

Rabbit Polyclonal Anti-MFAP1 Antibody

Product Images

WB Suggested Anti-MFAP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human brain

• 

  Host: Rabbit; Target Name: MFAP1; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml; MFAP1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MFAP1 antibody: synthetic peptide directed towards the middle region of human MFAP1. Synthetic peptide located within the following region: TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: microfibrillar associated protein 1
• Database Link:
  NP_005917
  Entrez Gene 4236 Human
  UniProt ID P55081
• Background: Component of the elastin-associated microfibrils.
• Synonyms: microfibrillar-associated protein 1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Secreted Protein