Klf3 Rabbit Polyclonal Antibody

CAT#: TA345206

Rabbit Polyclonal Anti-Klf3 Antibody

Product Images

Host: Rabbit; Target Name: Klf3; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Klf3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Klf3. Synthetic peptide located within the following region: MLMFDPVPVKQEAMDPVSVSFPSNYIESMKPNKYGVIYSTPLPDKFFQTP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: Kruppel-like factor 3 (basic)
• Database Link:
  NP_032479
  Entrez Gene 16599 Mouse
  UniProt ID Q60980
• Background: Klf3 binds to the CACCC box of erythroid cell-expressed genes. It may play a role in hematopoiesis.
• Synonyms: BKLF; MGC48279; TEF-2
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Dog: 92%; Mouse: 86%