HMG20A Rabbit Polyclonal Antibody

CAT#: TA345242

Rabbit Polyclonal Anti-HMG20A Antibody

Product Images

WB Suggested Anti-HMG20A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HMG20A antibody: synthetic peptide directed towards the C terminal of human HMG20A. Synthetic peptide located within the following region: SMPLPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: high mobility group 20A
• Database Link:
  NP_060670
  Entrez Gene 10363 Human
  UniProt ID Q9NP66
• Background: HMG20A plays a role in neuronal differentiation as chromatin-associated protein. HMG20A acts as inhibitor of HMG20B. HMG20A overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. HMG20A involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4
• Synonyms: HMGX1; HMGXB1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors