NFAT2 (NFATC1) Rabbit Polyclonal Antibody

CAT#: TA345245

Rabbit Polyclonal Anti-ZNF83 Antibody

Product Images

WB Suggested Anti-ZNF83 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF83 antibody: synthetic peptide directed towards the N terminal of human ZNF83. Synthetic peptide located within the following region: MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: nuclear factor of activated T-cells 1
• Database Link:
  NP_006153
  Entrez Gene 4772 Human
  UniProt ID O95644
• Background: ZNF83 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 15 C2H2-type zinc fingers. ZNF83 may be involved in transcriptional regulation.
• Synonyms: NF-ATC; NF-ATc1.2; NFAT2; NFATc
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Axon guidance, B cell receptor signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway