ZNF444 Rabbit Polyclonal Antibody

CAT#: TA345248

Rabbit Polyclonal Anti-ZNF444 Antibody

Product Images

WB Suggested Anti-ZNF444 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate; ZNF444 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Rabbit Anti-ZNF444 antibody; Paraffin Embedded Tissue: Human Lung cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF444 antibody: synthetic peptide directed towards the C terminal of human ZNF444. Synthetic peptide located within the following region: ACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: zinc finger protein 444
• Database Link:
  NP_060807
  Entrez Gene 55311 Human
  UniProt ID Q8N0Y2
• Background: ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, which strongly suggested that ZNF444 is a transcriptional regulator.ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534). [supplied by OMIM]
• Synonyms: EZF-2; EZF2; ZSCAN17
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors