ZNF286 (ZNF286A) Rabbit Polyclonal Antibody

CAT#: TA345290

Rabbit Polyclonal Anti-ZNF286 Antibody

Product Images

WB Suggested Anti-ZNF286 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate;ZNF286A is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF286 antibody: synthetic peptide directed towards the C terminal of human ZNF286. Synthetic peptide located within the following region: GKAFIHSSALIQHQRTHTGEKPFRCNECGKSFKCSSSLIRHQRVHTEEQP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: zinc finger protein 286A
• Database Link:
  NP_065703
  Entrez Gene 57335 Human
  UniProt ID Q9HBT8
• Background: ZNF286 may be involved in transcriptional regulation.
• Synonyms: ZNF286
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 92%

Reference Data

• Protein Families: Transcription Factors