ZNFN1A4 (IKZF4) Rabbit Polyclonal Antibody

CAT#: TA345363

Rabbit Polyclonal Anti-IKZF4 Antibody

Product Images

WB Suggested Anti-IKZF4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 721_B cell lysate; IKZF4 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IKZF4 antibody: synthetic peptide directed towards the n terminal of human IKZF4. Synthetic peptide located within the following region: GSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIMESLFCESSGDSSLEKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: IKAROS family zinc finger 4
• Database Link:
  NP_071910
  Entrez Gene 64375 Human
  UniProt ID Q9H2S9
• Background: Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-436 AC034102.32 139959-140394 c 437-975 DA797441.1 1-539 976-5506 BX647761.1 546-5076
• Synonyms: EOS; ZNFN1A4
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%

Reference Data

• Protein Families: Transcription Factors