KDM2B Rabbit Polyclonal Antibody

CAT#: TA345447

Rabbit Polyclonal Anti-FBXL10 Antibody

Product Images

WB Suggested Anti-FBXL10 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FBXL10 antibody: synthetic peptide directed towards the middle region of human FBXL10. Synthetic peptide located within the following region: LSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 152 kDa
• Gene Name: lysine demethylase 2B
• Database Link:
  NP_115979
  Entrez Gene 84678 Human
  UniProt ID Q8NHM5
• Background: FBXL10 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which fun
• Synonyms: CXXC2; Fbl10; FBXL10; JHDM1B; PCCX2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome