Islet 2 (ISL2) Rabbit Polyclonal Antibody

CAT#: TA345530

Rabbit Polyclonal Anti-ISL2 Antibody

Product Images

WB Suggested Anti-ISL2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ISL2 antibody: synthetic peptide directed towards the N terminal of human ISL2. Synthetic peptide located within the following region: MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: ISL LIM homeobox 2
• Database Link:
  NP_665804
  Entrez Gene 64843 Human
  UniProt ID Q96A47
• Background: ISL2 is the transcriptional factor that defines subclasses of motoneurons that segregate into columns in the spinal cord and select distinct axon pathways.
• Synonyms: FLJ10160
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 92%

Reference Data

• Protein Families: Transcription Factors