ZNF398 Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "ZNF398"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF398 antibody: synthetic peptide directed towards the C terminal of human ZNF398. Synthetic peptide located within the following region: GCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYGEGSGGGVL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 71 kDa |
Gene Name | zinc finger protein 398 |
Database Link | |
Background | ZNF398 is a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. This protein acts as a transcriptional activator.This gene encodes a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. The encoded protein acts as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene. Other transcript variants have been described, but their full length sequence has not been determined. |
Synonyms | P51; P71; ZER6 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rat: 79%; Mouse: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.