PHAP1 (ANP32A) Rabbit Polyclonal Antibody

CAT#: TA345683

Rabbit Polyclonal Anti-ANP32A Antibody

Product Images

WB Suggested Anti-ANP32A Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate.ANP32A is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Rabbit Anti-ANP32A Antibody; Paraffin Embedded Tissue: Human Heart; Cellular Data: Myocardial cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the N terminal of human ANP32A. Synthetic peptide located within the following region: MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: acidic nuclear phosphoprotein 32 family member A
• Database Link:
  NP_006296
  Entrez Gene 8125 Human
  UniProt ID P39687
• Background: ANP32A is a novel potent heat-stable inhibitor protein of protein phosphatase 2A. It may play a key role in self-renewing cell populations where it may act in the nucleus to limit their sensitivity to transformation. Being a tumor suppressor, ANP32A represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity.
• Synonyms: C15orf1; HPPCn; I1PP2A; LANP; MAPM; PHAP1; PHAPI; PP32
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Dog: 86%; Rat: 86%; Guinea pig: 86%; Mouse: 79%; Sheep: 77%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency