EXOSC10 Rabbit Polyclonal Antibody

CAT#: TA345696

Rabbit Polyclonal Anti-EXOSC10 Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of exosome component 10 (EXOSC10), transcript variant 1
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "EXOSC10"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-EXOSC10 antibody: synthetic peptide directed towards the C terminal of human EXOSC10. Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 97 kDa
Gene Name exosome component 10
Background EXOSC10 contains 1 HRDC domain and 1 3'-5' exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.
Synonyms p2; p3; p4; PM; PM-Scl; PMSCL; PMSCL2; RRP6; Rrp6p; Scl-100
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79%
Reference Data
Protein Pathways RNA degradation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.