CARS1 Rabbit Polyclonal Antibody

CAT#: TA345735

Rabbit Polyclonal Anti-CARS Antibody

Product Images

Host: Rabbit; Target Name: CARS; Sample Tissue: Jurkat Whole cell lysates; Antibody Dilution: 1.0 ug/ml.CARS is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CARS antibody is: synthetic peptide directed towards the N-terminal region of Human CARS. Synthetic peptide located within the following region: ADSSGQQAPDYRSILSISDEAARAQALNEHLSTRSYVQGYSLSQADVDAF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: cysteinyl-tRNA synthetase
• Database Link:
  NP_001014437
  Entrez Gene 833 Human
  UniProt ID P49589
• Background: CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. CARS gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
• Synonyms: CARS1; CYSRS; MGC:11246
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rat: 86%; Rabbit: 86%; Pig: 79%; Mouse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Aminoacyl-tRNA biosynthesis