DAZL Rabbit Polyclonal Antibody

CAT#: TA345772

Rabbit Polyclonal Anti-DAZL Antibody

Product Images

Host: Rabbit; Target Name: DAZL; Sample Tissue: Stomach tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DAZL antibody is: synthetic peptide directed towards the C-terminal region of Human DAZL. Synthetic peptide located within the following region: PPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: deleted in azoospermia like
• Database Link:
  NP_001342
  Entrez Gene 13164 MouseEntrez Gene 1618 Human
  UniProt ID Q92904
• Background: DAZ (Deleted in AZoospermia) is the potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. DAZL is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of the autosomal gene encoding DAZL during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in the Dazl gene have been linked to severe spermatogenic failure and infertility in males.
• Synonyms: DAZH; DAZL1; DAZLA; SPGYLA
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%