DAZL Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of deleted in azoospermia-like (DAZL)
USD 396.00
Other products for "DAZL"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DAZL antibody: synthetic peptide directed towards the C terminal of human DAZL. Synthetic peptide located within the following region: EVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 33 kDa |
Gene Name | deleted in azoospermia like |
Database Link | |
Background | DAZ (Deleted in AZoospermia) is the potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. DAZL is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of the autosomal gene encoding DAZL during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in the Dazl gene have been linked to severe spermatogenic failure and infertility in males.The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | DAZH; DAZL1; DAZLA; SPGYLA |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Goat: 93%; Mouse: 93%; Sheep: 93%; Bovine: 93%; Horse: 92%; Pig: 86%; Rat: 86%; Guinea pig: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.