SRP19 Rabbit Polyclonal Antibody

CAT#: TA345833

Rabbit Polyclonal Anti-SRP19 Antibody

Product Images

WB Suggested Anti-SRP19 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate; SRP19 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Rabbit Anti-SRP19 Antibody; Paraffin Embedded Tissue: Human Skin; Cellular Data: Squamous epithelial cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SRP19 antibody: synthetic peptide directed towards the middle region of human SRP19. Synthetic peptide located within the following region: LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: signal recognition particle 19kDa
• Database Link:
  NP_003126
  Entrez Gene 6728 Human
  UniProt ID P09132
• Background: SRP19 belongs to the SRP19 family. It is signal-recognition-particle assembly and binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.
• Synonyms: signal recognition particle 19kDa
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rat: 92%; Mouse: 92%; Rabbit: 85%; Zebrafish: 77%

Reference Data

• Protein Pathways: Protein export