Dusp11 Rabbit Polyclonal Antibody

CAT#: TA345841

Rabbit Polyclonal Anti-Dusp11 Antibody

Product Images

Host: Rabbit; Target Name: Dusp11; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Dusp11 antibody is: synthetic peptide directed towards the middle region of Mouse Dusp11. Synthetic peptide located within the following region: AFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)
• Database Link:
  NP_082375
  Entrez Gene 72102 Mouse
  UniProt ID Q6NXK5
• Background: It has both, RNA 5'-diphosphatase and 5'-triphosphatase activities, but displays a poor protein-tyrosine phosphatase activity.Dusp11 binds to RNA. Dusp11 may participate in nuclear mRNA metabolism.
• Synonyms: PIR1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Rat: 79%; Horse: 79%; Mouse: 79%