Dusp11 Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "Dusp11"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Dusp11 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GQRMPGTRFIAFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLII |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 38 kDa |
Gene Name | dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) |
Database Link | |
Background | It has both, RNA 5'-diphosphatase and 5'-triphosphatase activities, but displays a poor protein-tyrosine phosphatase activity.Dusp11 binds to RNA. Dusp11 may participate in nuclear mRNA metabolism. |
Synonyms | PIR1 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Pig: 92%; Dog: 86%; Guinea pig: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.