CPSF6 Rabbit Polyclonal Antibody

CAT#: TA345993

Rabbit Polyclonal Anti-CPSF6 Antibody

Product Images

WB Suggested Anti-CPSF6 Antibody Titration: 0.3125 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysateCPSF6 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Rabbit Anti-CPSF6 Antibody; Paraffin Embedded Tissue: Human Muscle; Cellular Data: Skeletal muscle cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Sample Type: SKOV3; Primary Antibody Dilution: 4 ug/ml; Secondary Antibody: Anti-rabbit Alexa 546; Secondary Antibody Dilution: 2 ug/ml; Gene Name: CPSF6

Specifications

Product Data

• Applications: IF, IHC, WB
• Recommended Dilution: WB, IHC, IF
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CPSF6 antibody: synthetic peptide directed towards the middle region of human CPSF6. Synthetic peptide located within the following region: PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: cleavage and polyadenylation specific factor 6
• Database Link:
  NP_008938
  Entrez Gene 11052 Human
  UniProt ID Q16630
• Background: CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins.
• Synonyms: CFIM; CFIM68; HPBRII-4; HPBRII-7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%