WDR8 (WRAP73) Rabbit Polyclonal Antibody

CAT#: TA345999

Rabbit Polyclonal Anti-WDR8 Antibody

Product Images

WB Suggested Anti-WDR8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WDR8 antibody: synthetic peptide directed towards the middle region of human WDR8. Synthetic peptide located within the following region: GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: WD repeat containing, antisense to TP73
• Database Link:
  NP_060288
  Entrez Gene 49856 Human
  UniProt ID Q9P2S5
• Background: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes.
• Synonyms: WDR8
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Families: Stem cell - Pluripotency