SFTPC Rabbit Polyclonal Antibody

CAT#: TA346095

Rabbit Polyclonal Anti-SFTPC Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human surfactant protein C (SFTPC)
    • 20 ug

USD 823.00


Transient overexpression lysate of surfactant protein C (SFTPC)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "SFTPC"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SFTPC antibody: synthetic peptide directed towards the N terminal of human SFTPC. Synthetic peptide located within the following region: MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 21 kDa
Gene Name surfactant protein C
Background This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth.
Synonyms BRICD6; PSP-C; SFTP2; SMDP2; SP-C
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 86%; Guinea pig: 86%; Sheep: 85%; Mouse: 79%
Reference Data
Protein Families Secreted Protein, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.