PON3 Rabbit Polyclonal Antibody

CAT#: TA346236

Rabbit Polyclonal Anti-PON3 Antibody

Product Images

WB Suggested Anti-PON3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: COLO205 cell lysatePON3 is supported by BioGPS gene expression data to be expressed in COLO205

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PON3 antibody: synthetic peptide directed towards the middle region of human PON3. Synthetic peptide located within the following region: FKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: paraoxonase 3
• Database Link:
  NP_000931
  Entrez Gene 5446 Human
  UniProt ID Q15166
• Background: This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). The protein also rapidly hydrolyzes lactones and can inhibit the oxidation of low-density lipoprotein (LDL), a function that is believed to slow the initiation and progression of atherosclerosis. Alternatively spliced variants which encode different protein isoforms have been described; however, only one has been fully characterized.
• Synonyms: lactonase 3; paraoxanase-3; paraoxonase 3; serum paraoxonase
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Sheep: 85%

Reference Data

• Protein Families: Secreted Protein, Transmembrane
• Protein Pathways: Metabolic pathways