C9orf127 (TMEM8B) Rabbit Polyclonal Antibody

CAT#: TA346271

Rabbit Polyclonal Anti-C9orf127 Antibody

Product Images

WB Suggested Anti-C9orf127 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C9orf127 antibody: synthetic peptide directed towards the C terminal of human C9orf127. Synthetic peptide located within the following region: FLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: transmembrane protein 8B
• Database Link:
  NP_057530
  Entrez Gene 51754 Human
  UniProt ID A6NDV4
• Background: Overexpression of C9orf127 can influence the distribution of the cell cycle in NPC cells and it also plays a role in cell adhesion modulation in NPC cells.
• Synonyms: C9orf127; NAG-5; NAG5; NGX6
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane