C9orf127 (TMEM8B) Rabbit Polyclonal Antibody

CAT#: TA346271

Rabbit Polyclonal Anti-C9orf127 Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of transmembrane protein 8B (TMEM8B), transcript variant 3
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "TMEM8B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C9orf127 antibody: synthetic peptide directed towards the C terminal of human C9orf127. Synthetic peptide located within the following region: FLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 52 kDa
Gene Name transmembrane protein 8B
Background Overexpression of C9orf127 can influence the distribution of the cell cycle in NPC cells and it also plays a role in cell adhesion modulation in NPC cells.
Synonyms C9orf127; NAG-5; NAG5; NGX6
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.