Apof Rabbit Polyclonal Antibody

CAT#: TA346301

Rabbit Polyclonal Anti-Apof Antibody

Product Images

WB Suggested Anti-Apof Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Rat Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Apof antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LLPAVGTYYNLGTALYYAIKNCTDKAKERGRDGAIDLGYDLLMTMVGMSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: apolipoprotein F
• Database Link:
  NP_001019522
  Entrez Gene 500761 Rat
  UniProt ID Q5M889
• Background: Apof is a minor apolipoprotein that associates with LDL. Apof inhibits cholesteryl ester transfer protein (CETP) activity and appears to be an important regulator of cholesterol transport. Apof also associates to a lesser degree with VLDL, Apo-AI and Apo-AII.
• Synonyms: Apo-F; DKFZp781G18150; LTIP; MGC22520
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Horse: 86%; Guinea pig: 86%