Apof Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "Apof"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Rat |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Apof antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LLPAVGTYYNLGTALYYAIKNCTDKAKERGRDGAIDLGYDLLMTMVGMSG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 34 kDa |
| Gene Name | apolipoprotein F |
| Database Link | |
| Background | Apof is a minor apolipoprotein that associates with LDL. Apof inhibits cholesteryl ester transfer protein (CETP) activity and appears to be an important regulator of cholesterol transport. Apof also associates to a lesser degree with VLDL, Apo-AI and Apo-AII. |
| Synonyms | Apo-F; DKFZp781G18150; LTIP; MGC22520 |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Horse: 86%; Guinea pig: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China