GNAZ Rabbit Polyclonal Antibody

CAT#: TA346317

Rabbit Polyclonal Anti-GNAZ Antibody

Product Images

Host: Rabbit; Target Name: GNAZ; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-GNAZ Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate.GNAZ is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GNAZ antibody: synthetic peptide directed towards the N terminal of human GNAZ. Synthetic peptide located within the following region: LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: G protein subunit alpha z
• Database Link:
  NP_002064
  Entrez Gene 2781 Human
  UniProt ID P19086
• Background: GNAZ is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids.The protein encoded by this gene is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This encoded protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: alpha z polypeptide; guanine nucleotide binding protein; guanine nucleotide binding protein (G protein); transducin alpha
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Long-term depression