PF4V1 Rabbit Polyclonal Antibody

CAT#: TA346326

Rabbit Polyclonal Anti-PF4V1 Antibody

Product Images

WB Suggested Anti-PF4V1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PF4V1 antibody: synthetic peptide directed towards the middle region of human PF4V1. Synthetic peptide located within the following region: RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: platelet factor 4 variant 1
• Database Link:
  NP_002611
  Entrez Gene 5197 Human
  UniProt ID P10720
• Background: PF4V1 is the inhibitor of angiogenesis. PF4V1 is the inhibitor of endothelial cell chemotaxis (in vitro).
• Synonyms: CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 85%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction