Statherin (STATH) Rabbit Polyclonal Antibody

CAT#: TA346343

Rabbit Polyclonal Anti-STATH Antibody

Product Images

WB Suggested Anti-STATH Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STATH antibody: synthetic peptide directed towards the middle region of human STATH. Synthetic peptide located within the following region: MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 7 kDa
• Gene Name: statherin
• Database Link:
  NP_003145
  Entrez Gene 6779 Human
  UniProt ID P02808
• Background: STATH is a salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.
• Synonyms: STR
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 90%

Reference Data

• Protein Families: Secreted Protein